Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,138
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,057
  3. Avatar for xkcd 13. xkcd 1 pt. 8,985
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,908
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 8,828
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,447
  7. Avatar for USD_IMB 17. USD_IMB 1 pt. 7,557
  8. Avatar for Cannabis Crew 18. Cannabis Crew 1 pt. 6,654
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,307
  1. Avatar for emiilykim 221. emiilykim Lv 1 1 pt. 6,181
  2. Avatar for kvasirthewise 222. kvasirthewise Lv 1 1 pt. 6,055
  3. Avatar for liboka 223. liboka Lv 1 1 pt. 5,933
  4. Avatar for George-Anton 224. George-Anton Lv 1 1 pt. 5,928
  5. Avatar for lludo 225. lludo Lv 1 1 pt. 5,922
  6. Avatar for zeho825 226. zeho825 Lv 1 1 pt. 5,911
  7. Avatar for xerq 227. xerq Lv 1 1 pt. 5,904
  8. Avatar for BroC4 228. BroC4 Lv 1 1 pt. 5,350
  9. Avatar for hredinge 229. hredinge Lv 1 1 pt. 5,289
  10. Avatar for opferkopf 230. opferkopf Lv 1 1 pt. 5,045

Comments