Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups


  1. Avatar for Contenders 100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139

  1. Avatar for Galaxie 21. Galaxie Lv 1 2 pts. 9,613
  2. Avatar for spvincent 22. spvincent Lv 1 1 pt. 9,604
  3. Avatar for ManVsYard 23. ManVsYard Lv 1 1 pt. 9,595
  4. Avatar for Deleted player 24. Deleted player pts. 9,593
  5. Avatar for alcor29 25. alcor29 Lv 1 1 pt. 9,592
  6. Avatar for alwen 26. alwen Lv 1 1 pt. 9,540
  7. Avatar for kabubi 27. kabubi Lv 1 1 pt. 9,481
  8. Avatar for Vredeman 28. Vredeman Lv 1 1 pt. 9,455
  9. Avatar for Bruno Kestemont 29. Bruno Kestemont Lv 1 1 pt. 9,449
  10. Avatar for Hollinas 30. Hollinas Lv 1 1 pt. 9,440

Comments