Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups


  1. Avatar for Contenders 100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139

  1. Avatar for Deleted player 11. Deleted player pts. 9,580
  2. Avatar for fiendish_ghoul 12. fiendish_ghoul Lv 1 81 pts. 9,528
  3. Avatar for TomTaylor 13. TomTaylor Lv 1 80 pts. 9,506
  4. Avatar for Galaxie 14. Galaxie Lv 1 78 pts. 9,484
  5. Avatar for Mike Cassidy 15. Mike Cassidy Lv 1 76 pts. 9,479
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 75 pts. 9,472
  7. Avatar for Timo van der Laan 17. Timo van der Laan Lv 1 73 pts. 9,468
  8. Avatar for kabubi 18. kabubi Lv 1 72 pts. 9,463
  9. Avatar for Scopper 19. Scopper Lv 1 71 pts. 9,447
  10. Avatar for mimi 20. mimi Lv 1 69 pts. 9,438

Comments