Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups


  1. Avatar for Contenders 100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139

  1. Avatar for jhostert 211. jhostert Lv 1 1 pt. 6,619
  2. Avatar for AO91 212. AO91 Lv 1 1 pt. 6,552
  3. Avatar for mightyroy 213. mightyroy Lv 1 1 pt. 6,475
  4. Avatar for rowan.l.c 214. rowan.l.c Lv 1 1 pt. 6,453
  5. Avatar for GreggieG 215. GreggieG Lv 1 1 pt. 6,401
  6. Avatar for LLeo 216. LLeo Lv 1 1 pt. 6,366
  7. Avatar for RyanDekle 217. RyanDekle Lv 1 1 pt. 6,264
  8. Avatar for kjolit09785 218. kjolit09785 Lv 1 1 pt. 6,246
  9. Avatar for naulneyung 219. naulneyung Lv 1 1 pt. 6,220
  10. Avatar for hc820404 220. hc820404 Lv 1 1 pt. 6,185

Comments