Placeholder image of a protein
Icon representing a puzzle

1286: Unsolved De-novo Freestyle 87

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 16, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEEEIKKEIEKIKEWFKKGEGGYRLEINEDGREIEVEIRSEGTLRIRLDNVHEELKKEFEKLKEEWKKIK

Top groups


  1. Avatar for Contenders 100 pts. 9,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,655
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,642
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,481
  6. Avatar for Go Science 6. Go Science 20 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,354
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,168
  9. Avatar for freefolder 9. freefolder 6 pts. 9,161
  10. Avatar for Deleted group 10. Deleted group pts. 9,139

  1. Avatar for TastyMunchies 51. TastyMunchies Lv 1 35 pts. 9,167
  2. Avatar for johnmitch 52. johnmitch Lv 1 34 pts. 9,163
  3. Avatar for Imeturoran 53. Imeturoran Lv 1 34 pts. 9,161
  4. Avatar for YeshuaLives 54. YeshuaLives Lv 1 33 pts. 9,148
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 32 pts. 9,139
  6. Avatar for molleke 56. molleke Lv 1 31 pts. 9,138
  7. Avatar for ZeroLeak7 57. ZeroLeak7 Lv 1 31 pts. 9,138
  8. Avatar for Elcesador 58. Elcesador Lv 1 30 pts. 9,114
  9. Avatar for caglar 59. caglar Lv 1 29 pts. 9,105
  10. Avatar for phi16 60. phi16 Lv 1 28 pts. 9,084

Comments