1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Summary

• Created: September 21, 2016
• Expires: September 28, 2016 at 18:00 UTC
• Max points: 100

Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:

MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

• 11. Russian team 5 pts. 9,612
• 12. It's over 9000! 4 pts. 9,599
• 13. xkcd 2 pts. 9,516
• 14. SETI.Germany 2 pts. 9,326
• 15. USD_IMB 1 pt. 9,115
• 16. Lakeland BIO353 1 pt. 8,565
• 17. Rice Biochemistry 1 pt. 8,525
• 18. freefolder 1 pt. 8,336
• 19. Skidmore CH 341 1 pt. 8,191
• 20. Window Group 1 pt. 7,949

Top soloists

• 1. bertro 100 pts. 13,777
• 2. Aubade01 99 pts. 13,763
• 3. frood66 97 pts. 13,762
• 4. Bletchley Park 95 pts. 13,761
• 5. tokens 93 pts. 13,752
• 6. Bruno Kestemont 91 pts. 13,751
• 7. shettler 89 pts. 13,743
• 8. Timo van der Laan 87 pts. 13,739
• 9. gitwut 85 pts. 13,738
• 10. TomTaylor 84 pts. 13,737

Comments

[bertro]

Really nice to give us this ED, that will train the eye and tool usage for future ones.

Thanks

[frood66]

I would like to know the level of cloud definition (for reference) I know others would too.

[actiasluna]

I'm still crappy at them, but sure this will help given time. More of the same for practice, please!