Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 9,612
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 9,599
  3. Avatar for xkcd 13. xkcd 2 pts. 9,516
  4. Avatar for SETI.Germany 14. SETI.Germany 2 pts. 9,326
  5. Avatar for USD_IMB 15. USD_IMB 1 pt. 9,115
  6. Avatar for Lakeland BIO353 16. Lakeland BIO353 1 pt. 8,565
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 8,525
  8. Avatar for freefolder 18. freefolder 1 pt. 8,336
  9. Avatar for Skidmore CH 341 19. Skidmore CH 341 1 pt. 8,191
  10. Avatar for Window Group 20. Window Group 1 pt. 7,949

  1. Avatar for bertro
    1. bertro Lv 1
    100 pts. 13,777
  2. Avatar for Aubade01 2. Aubade01 Lv 1 99 pts. 13,763
  3. Avatar for frood66 3. frood66 Lv 1 97 pts. 13,762
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 95 pts. 13,761
  5. Avatar for tokens 5. tokens Lv 1 93 pts. 13,752
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 91 pts. 13,751
  7. Avatar for shettler 7. shettler Lv 1 89 pts. 13,743
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 87 pts. 13,739
  9. Avatar for gitwut 9. gitwut Lv 1 85 pts. 13,738
  10. Avatar for TomTaylor 10. TomTaylor Lv 1 84 pts. 13,737

Comments