Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for Patato 101. Patato Lv 1 8 pts. 9,625
  2. Avatar for ComputerMage 102. ComputerMage Lv 1 8 pts. 9,612
  3. Avatar for BCAA 103. BCAA Lv 1 8 pts. 9,599
  4. Avatar for Paulo Roque 104. Paulo Roque Lv 1 8 pts. 9,594
  5. Avatar for medaka 105. medaka Lv 1 7 pts. 9,580
  6. Avatar for pfirth 106. pfirth Lv 1 7 pts. 9,572
  7. Avatar for RestrictionEndoNykolease 107. RestrictionEndoNykolease Lv 1 7 pts. 9,559
  8. Avatar for krisha_lim 108. krisha_lim Lv 1 7 pts. 9,541
  9. Avatar for gilleain 109. gilleain Lv 1 6 pts. 9,525
  10. Avatar for Sissue 110. Sissue Lv 1 6 pts. 9,519

Comments