Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803

  1. Avatar for froggs554 121. froggs554 Lv 1 4 pts. 9,368
  2. Avatar for Jesse Pinkman 122. Jesse Pinkman Lv 1 4 pts. 9,356
  3. Avatar for demeter900 123. demeter900 Lv 1 4 pts. 9,352
  4. Avatar for adrian.kuttesch 124. adrian.kuttesch Lv 1 4 pts. 9,336
  5. Avatar for rinze 125. rinze Lv 1 4 pts. 9,335
  6. Avatar for SouperGenious 126. SouperGenious Lv 1 4 pts. 9,333
  7. Avatar for aendgraend 127. aendgraend Lv 1 4 pts. 9,326
  8. Avatar for franckpirate 128. franckpirate Lv 1 3 pts. 9,326
  9. Avatar for leannerikicheever 129. leannerikicheever Lv 1 3 pts. 9,325
  10. Avatar for Atrus_Homeboy 130. Atrus_Homeboy Lv 1 3 pts. 9,321

Comments