Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for snoopydawg7 141. snoopydawg7 Lv 1 2 pts. 9,225
  2. Avatar for xpresi 142. xpresi Lv 1 2 pts. 9,220
  3. Avatar for kvasirthewise 143. kvasirthewise Lv 1 2 pts. 9,216
  4. Avatar for fryguy 144. fryguy Lv 1 2 pts. 9,209
  5. Avatar for jzchan34 145. jzchan34 Lv 1 2 pts. 9,192
  6. Avatar for Roukess67 146. Roukess67 Lv 1 2 pts. 9,192
  7. Avatar for klumpatsch 147. klumpatsch Lv 1 2 pts. 9,173
  8. Avatar for Hollinas 148. Hollinas Lv 1 2 pts. 9,170
  9. Avatar for pandapharmd 149. pandapharmd Lv 1 2 pts. 9,169
  10. Avatar for parsnip 150. parsnip Lv 1 2 pts. 9,168

Comments