Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803

  1. Avatar for multaq 181. multaq Lv 1 1 pt. 8,866
  2. Avatar for Cerzax 182. Cerzax Lv 1 1 pt. 8,864
  3. Avatar for iceslayer 183. iceslayer Lv 1 1 pt. 8,863
  4. Avatar for Mathias Coelho 185. Mathias Coelho Lv 1 1 pt. 8,856
  5. Avatar for bski23 186. bski23 Lv 1 1 pt. 8,844
  6. Avatar for richard c 187. richard c Lv 1 1 pt. 8,798
  7. Avatar for SPARKY25 188. SPARKY25 Lv 1 1 pt. 8,786
  8. Avatar for dz92127 189. dz92127 Lv 1 1 pt. 8,781
  9. Avatar for sor2018 190. sor2018 Lv 1 1 pt. 8,780

Comments