Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for Scopper 11. Scopper Lv 1 82 pts. 13,731
  2. Avatar for grogar7 12. grogar7 Lv 1 80 pts. 13,729
  3. Avatar for Mike Lewis 13. Mike Lewis Lv 1 79 pts. 13,729
  4. Avatar for actiasluna 14. actiasluna Lv 1 77 pts. 13,728
  5. Avatar for kabubi 15. kabubi Lv 1 75 pts. 13,728
  6. Avatar for LociOiling 16. LociOiling Lv 1 74 pts. 13,727
  7. Avatar for mimi 17. mimi Lv 1 72 pts. 13,725
  8. Avatar for YeshuaLives 18. YeshuaLives Lv 1 71 pts. 13,719
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 69 pts. 13,712
  10. Avatar for dembones 20. dembones Lv 1 68 pts. 13,705

Comments