Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803

  1. Avatar for Kingathealchemist 211. Kingathealchemist Lv 1 1 pt. 8,541
  2. Avatar for StephanieGreen 212. StephanieGreen Lv 1 1 pt. 8,525
  3. Avatar for 12jsl3 213. 12jsl3 Lv 1 1 pt. 8,513
  4. Avatar for TidusCZ 214. TidusCZ Lv 1 1 pt. 8,488
  5. Avatar for 01010011111 215. 01010011111 Lv 1 1 pt. 8,470
  6. Avatar for glaciall 216. glaciall Lv 1 1 pt. 8,456
  7. Avatar for mirjamvandelft 217. mirjamvandelft Lv 1 1 pt. 8,427
  8. Avatar for ickypimp 218. ickypimp Lv 1 1 pt. 8,376
  9. Avatar for Altercomp 219. Altercomp Lv 1 1 pt. 8,336
  10. Avatar for Neutrons 220. Neutrons Lv 1 1 pt. 8,334

Comments