Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for DeusRAI 221. DeusRAI Lv 1 1 pt. 8,273
  2. Avatar for rstix 222. rstix Lv 1 1 pt. 8,191
  3. Avatar for IMAO486 223. IMAO486 Lv 1 1 pt. 8,136
  4. Avatar for pkoz 224. pkoz Lv 1 1 pt. 8,119
  5. Avatar for nekij 225. nekij Lv 1 1 pt. 8,103
  6. Avatar for jflat06 226. jflat06 Lv 1 1 pt. 7,949
  7. Avatar for jermainiac 227. jermainiac Lv 1 1 pt. 7,904
  8. Avatar for robkleffner 228. robkleffner Lv 1 1 pt. 7,753
  9. Avatar for PortableFun 229. PortableFun Lv 1 1 pt. 7,753
  10. Avatar for miswerdloff 230. miswerdloff Lv 1 1 pt. 7,617

Comments