Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for noMoon 241. noMoon Lv 1 1 pt. 6,816
  2. Avatar for mzeffer 242. mzeffer Lv 1 1 pt. 6,803
  3. Avatar for steter 243. steter Lv 1 1 pt. 6,803
  4. Avatar for endofzero 244. endofzero Lv 1 1 pt. 6,803
  5. Avatar for Larissa Rosales 245. Larissa Rosales Lv 1 1 pt. 6,803
  6. Avatar for optimus_f_prime 246. optimus_f_prime Lv 1 1 pt. 6,803
  7. Avatar for Arne Heessels 247. Arne Heessels Lv 1 1 pt. 6,803
  8. Avatar for DotMatrix 248. DotMatrix Lv 1 1 pt. 6,803
  9. Avatar for spvincent 249. spvincent Lv 1 1 pt. 6,803
  10. Avatar for johnmangala 250. johnmangala Lv 1 1 pt. 6,803

Comments