Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for retiredmichael 21. retiredmichael Lv 1 66 pts. 13,702
  2. Avatar for Geyalust 22. Geyalust Lv 1 65 pts. 13,701
  3. Avatar for pauldunn 23. pauldunn Lv 1 64 pts. 13,699
  4. Avatar for Mark- 24. Mark- Lv 1 62 pts. 13,697
  5. Avatar for jobo0502 25. jobo0502 Lv 1 61 pts. 13,684
  6. Avatar for pvc78 26. pvc78 Lv 1 60 pts. 13,674
  7. Avatar for alwen 27. alwen Lv 1 58 pts. 13,667
  8. Avatar for caglar 28. caglar Lv 1 57 pts. 13,667
  9. Avatar for ViJay7019 29. ViJay7019 Lv 1 56 pts. 13,666
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 54 pts. 13,640

Comments