Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for joremen 31. joremen Lv 1 53 pts. 13,638
  2. Avatar for spmm 32. spmm Lv 1 52 pts. 13,632
  3. Avatar for Alistair69 33. Alistair69 Lv 1 51 pts. 13,632
  4. Avatar for Deleted player 34. Deleted player pts. 13,630
  5. Avatar for Vredeman 35. Vredeman Lv 1 49 pts. 13,627
  6. Avatar for Glen B 36. Glen B Lv 1 48 pts. 13,624
  7. Avatar for drumpeter18yrs9yrs 37. drumpeter18yrs9yrs Lv 1 46 pts. 13,597
  8. Avatar for Susume 38. Susume Lv 1 45 pts. 13,592
  9. Avatar for Bautho 39. Bautho Lv 1 44 pts. 13,581
  10. Avatar for dbuske 40. dbuske Lv 1 43 pts. 13,569

Comments