Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803

  1. Avatar for ZeroLeak7 41. ZeroLeak7 Lv 1 42 pts. 13,541
  2. Avatar for georg137 42. georg137 Lv 1 41 pts. 13,267
  3. Avatar for Blockhead2 43. Blockhead2 Lv 1 40 pts. 13,181
  4. Avatar for St. Eric Hindrance 44. St. Eric Hindrance Lv 1 39 pts. 13,046
  5. Avatar for Skippysk8s 45. Skippysk8s Lv 1 38 pts. 12,034
  6. Avatar for g_b 46. g_b Lv 1 38 pts. 11,988
  7. Avatar for KarenCH 47. KarenCH Lv 1 37 pts. 11,752
  8. Avatar for isaksson 48. isaksson Lv 1 36 pts. 11,745
  9. Avatar for senor pit 49. senor pit Lv 1 35 pts. 11,655
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 34 pts. 11,651

Comments