Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for diamonddays 51. diamonddays Lv 1 33 pts. 11,647
  2. Avatar for O Seki To 52. O Seki To Lv 1 32 pts. 11,644
  3. Avatar for Museka 53. Museka Lv 1 32 pts. 11,459
  4. Avatar for alcor29 54. alcor29 Lv 1 31 pts. 11,313
  5. Avatar for johnmitch 55. johnmitch Lv 1 30 pts. 10,783
  6. Avatar for pmdpmd 56. pmdpmd Lv 1 29 pts. 10,451
  7. Avatar for Deleted player 57. Deleted player pts. 10,444
  8. Avatar for reefyrob 58. reefyrob Lv 1 28 pts. 10,392
  9. Avatar for smilingone 59. smilingone Lv 1 27 pts. 10,352
  10. Avatar for dcrwheeler 60. dcrwheeler Lv 1 27 pts. 10,337

Comments