Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for Flagg65a 71. Flagg65a Lv 1 20 pts. 10,087
  2. Avatar for MicElephant 72. MicElephant Lv 1 19 pts. 10,061
  3. Avatar for dizzywings 73. dizzywings Lv 1 19 pts. 10,054
  4. Avatar for stomjoh 74. stomjoh Lv 1 18 pts. 10,042
  5. Avatar for andrewxc 75. andrewxc Lv 1 18 pts. 10,042
  6. Avatar for rezaefar 76. rezaefar Lv 1 17 pts. 10,033
  7. Avatar for xplocast1 77. xplocast1 Lv 1 17 pts. 10,004
  8. Avatar for jebbiek 78. jebbiek Lv 1 16 pts. 9,995
  9. Avatar for pmthomson90 79. pmthomson90 Lv 1 16 pts. 9,995
  10. Avatar for weitzen 80. weitzen Lv 1 15 pts. 9,984

Comments