Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for test_group1 21. test_group1 1 pt. 7,587
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,447
  3. Avatar for ZefferBio15 23. ZefferBio15 1 pt. 6,803
  1. Avatar for Deleted player 81. Deleted player pts. 9,976
  2. Avatar for gurch 82. gurch Lv 1 15 pts. 9,975
  3. Avatar for tomespen 83. tomespen Lv 1 14 pts. 9,922
  4. Avatar for johngran 84. johngran Lv 1 14 pts. 9,902
  5. Avatar for dssb 85. dssb Lv 1 13 pts. 9,895
  6. Avatar for JayD7217 86. JayD7217 Lv 1 13 pts. 9,865
  7. Avatar for sharondipity 87. sharondipity Lv 1 13 pts. 9,864
  8. Avatar for Vinara 88. Vinara Lv 1 12 pts. 9,861
  9. Avatar for altejoh 89. altejoh Lv 1 12 pts. 9,856
  10. Avatar for DraKoan 90. DraKoan Lv 1 12 pts. 9,834

Comments