Placeholder image of a protein
Icon representing a puzzle

1287: Revisiting Puzzle 71 with Density: Crystallin

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
September 21, 2016
Expires
Max points
100
Description

This is a repost of Puzzle 1284, now with an electron density map! This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1284.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 13,777
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 13,776
  3. Avatar for Contenders 3. Contenders 63 pts. 13,761
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 13,758
  5. Avatar for Go Science 5. Go Science 37 pts. 13,752
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 13,739
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 13,713
  8. Avatar for Deleted group 8. Deleted group pts. 13,597
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 11,644
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,995

  1. Avatar for BroC4 251. BroC4 Lv 1 1 pt. 6,803

Comments