Placeholder image of a protein
Icon representing a puzzle

1291: Dysferlin C2B Domain

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 29, 2016
Expires
Max points
100
Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help!



The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,179
  2. Avatar for freefolder 12. freefolder 1 pt. 7,695
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 7,598
  4. Avatar for Deleted group 14. Deleted group pts. 6,106
  5. Avatar for Biochem-AD17 15. Biochem-AD17 1 pt. 4,208
  6. Avatar for Russian team 16. Russian team 1 pt. 1,760
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for reefyrob 101. reefyrob Lv 1 7 pts. 7,756
  2. Avatar for mcummings 102. mcummings Lv 1 6 pts. 7,738
  3. Avatar for Kevonni 103. Kevonni Lv 1 6 pts. 7,727
  4. Avatar for dbuske 104. dbuske Lv 1 6 pts. 7,712
  5. Avatar for dizzywings 105. dizzywings Lv 1 6 pts. 7,704
  6. Avatar for Altercomp 106. Altercomp Lv 1 6 pts. 7,695
  7. Avatar for CakeorDeath 107. CakeorDeath Lv 1 5 pts. 7,674
  8. Avatar for YGK 108. YGK Lv 1 5 pts. 7,661
  9. Avatar for grogar7 109. grogar7 Lv 1 5 pts. 7,633
  10. Avatar for navn 110. navn Lv 1 5 pts. 7,620

Comments