Placeholder image of a protein
Icon representing a puzzle

1291: Dysferlin C2B Domain

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 29, 2016
Expires
Max points
100
Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help!



The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 8,179
  2. Avatar for freefolder 12. freefolder 1 pt. 7,695
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 7,598
  4. Avatar for Deleted group 14. Deleted group pts. 6,106
  5. Avatar for Biochem-AD17 15. Biochem-AD17 1 pt. 4,208
  6. Avatar for Russian team 16. Russian team 1 pt. 1,760
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0

  1. Avatar for jebbiek 141. jebbiek Lv 1 2 pts. 6,995
  2. Avatar for Bautho 142. Bautho Lv 1 1 pt. 6,967
  3. Avatar for M3chanicalFolder 143. M3chanicalFolder Lv 1 1 pt. 6,919
  4. Avatar for Tolen 144. Tolen Lv 1 1 pt. 6,879
  5. Avatar for bzipitidoo 145. bzipitidoo Lv 1 1 pt. 6,852
  6. Avatar for lamoille 146. lamoille Lv 1 1 pt. 6,833
  7. Avatar for woerty 147. woerty Lv 1 1 pt. 6,811
  8. Avatar for Dakkan1 148. Dakkan1 Lv 1 1 pt. 6,761
  9. Avatar for jermainiac 149. jermainiac Lv 1 1 pt. 6,631
  10. Avatar for larry25427 150. larry25427 Lv 1 1 pt. 6,621

Comments