Placeholder image of a protein
Icon representing a puzzle

1291: Dysferlin C2B Domain

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 29, 2016
Expires
Max points
100
Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help!



The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,179
  2. Avatar for freefolder 12. freefolder 1 pt. 7,695
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 7,598
  4. Avatar for Deleted group 14. Deleted group pts. 6,106
  5. Avatar for Biochem-AD17 15. Biochem-AD17 1 pt. 4,208
  6. Avatar for Russian team 16. Russian team 1 pt. 1,760
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for Madde 11. Madde Lv 1 81 pts. 9,127
  2. Avatar for Scopper 12. Scopper Lv 1 79 pts. 9,121
  3. Avatar for spvincent 13. spvincent Lv 1 77 pts. 9,109
  4. Avatar for MurloW 14. MurloW Lv 1 76 pts. 9,094
  5. Avatar for tokens 15. tokens Lv 1 74 pts. 9,093
  6. Avatar for pmdpmd 16. pmdpmd Lv 1 72 pts. 9,088
  7. Avatar for Galaxie 17. Galaxie Lv 1 71 pts. 9,079
  8. Avatar for gitwut 18. gitwut Lv 1 69 pts. 9,029
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 67 pts. 8,982
  10. Avatar for Mike Lewis 20. Mike Lewis Lv 1 66 pts. 8,963

Comments