Placeholder image of a protein
Icon representing a puzzle

1291: Dysferlin C2B Domain

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 29, 2016
Expires
Max points
100
Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help!



The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,179
  2. Avatar for freefolder 12. freefolder 1 pt. 7,695
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 7,598
  4. Avatar for Deleted group 14. Deleted group pts. 6,106
  5. Avatar for Biochem-AD17 15. Biochem-AD17 1 pt. 4,208
  6. Avatar for Russian team 16. Russian team 1 pt. 1,760
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for O Seki To 41. O Seki To Lv 1 39 pts. 8,701
  2. Avatar for randomlil 42. randomlil Lv 1 38 pts. 8,678
  3. Avatar for Anfinsen_slept_here 43. Anfinsen_slept_here Lv 1 38 pts. 8,665
  4. Avatar for markm457 44. markm457 Lv 1 37 pts. 8,616
  5. Avatar for alcor29 45. alcor29 Lv 1 36 pts. 8,585
  6. Avatar for Aubade01 46. Aubade01 Lv 1 35 pts. 8,575
  7. Avatar for TheGUmmer 47. TheGUmmer Lv 1 34 pts. 8,564
  8. Avatar for TomTaylor 48. TomTaylor Lv 1 33 pts. 8,562
  9. Avatar for heather-1 49. heather-1 Lv 1 32 pts. 8,532
  10. Avatar for ZeroLeak7 50. ZeroLeak7 Lv 1 31 pts. 8,521

Comments