Placeholder image of a protein
Icon representing a puzzle

1291: Dysferlin C2B Domain

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
September 29, 2016
Expires
Max points
100
Description

This is a domain of the human dysferlin protein. Dysferlin is found in muscle cells and associates with the cell membrane, although its exact function is unknown. Mutations in the dysferlin gene can cause a debilitating type of muscular dystrophy. See the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help!



The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups


  1. Avatar for Beta Folders 100 pts. 9,354
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,327
  3. Avatar for Contenders 3. Contenders 54 pts. 9,283
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,229
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,203
  6. Avatar for Go Science 6. Go Science 18 pts. 9,121
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,088
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 8,701
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,285
  10. Avatar for Deleted group 10. Deleted group pts. 8,227

  1. Avatar for tweak64 161. tweak64 Lv 1 1 pt. 6,252
  2. Avatar for Anamfija 162. Anamfija Lv 1 1 pt. 6,215
  3. Avatar for monkry 163. monkry Lv 1 1 pt. 6,187
  4. Avatar for nagistick 164. nagistick Lv 1 1 pt. 6,167
  5. Avatar for frostschutz 165. frostschutz Lv 1 1 pt. 6,164
  6. Avatar for Tuxtey 166. Tuxtey Lv 1 1 pt. 6,157
  7. Avatar for Restartbob 167. Restartbob Lv 1 1 pt. 6,114
  8. Avatar for shascott 168. shascott Lv 1 1 pt. 6,106
  9. Avatar for Boogiedanman7 169. Boogiedanman7 Lv 1 1 pt. 6,098
  10. Avatar for andrewxc 170. andrewxc Lv 1 1 pt. 6,062

Comments