Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897
  1. Avatar for JUMELLE54 101. JUMELLE54 Lv 1 6 pts. 8,735
  2. Avatar for dbuske 102. dbuske Lv 1 5 pts. 8,725
  3. Avatar for Alistair69 103. Alistair69 Lv 1 5 pts. 8,722
  4. Avatar for peterstumpf 104. peterstumpf Lv 1 5 pts. 8,713
  5. Avatar for Savas 105. Savas Lv 1 5 pts. 8,712
  6. Avatar for senor pit 106. senor pit Lv 1 5 pts. 8,706
  7. Avatar for leannerikicheever 107. leannerikicheever Lv 1 4 pts. 8,686
  8. Avatar for rinze 108. rinze Lv 1 4 pts. 8,667
  9. Avatar for Arne Heessels 109. Arne Heessels Lv 1 4 pts. 8,665
  10. Avatar for Formula350 110. Formula350 Lv 1 4 pts. 8,662

Comments