Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897
  1. Avatar for jebbiek 121. jebbiek Lv 1 3 pts. 8,560
  2. Avatar for cobaltteal 122. cobaltteal Lv 1 3 pts. 8,558
  3. Avatar for Restartbob 123. Restartbob Lv 1 2 pts. 8,557
  4. Avatar for klumpatsch 124. klumpatsch Lv 1 2 pts. 8,548
  5. Avatar for CakeorDeath 125. CakeorDeath Lv 1 2 pts. 8,542
  6. Avatar for uihcv 126. uihcv Lv 1 2 pts. 8,540
  7. Avatar for t012 127. t012 Lv 1 2 pts. 8,528
  8. Avatar for Hollinas 128. Hollinas Lv 1 2 pts. 8,521
  9. Avatar for bhfreagra 129. bhfreagra Lv 1 2 pts. 8,516
  10. Avatar for altejoh 130. altejoh Lv 1 2 pts. 8,514

Comments