Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897

  1. Avatar for Reldas 131. Reldas Lv 1 2 pts. 8,513
  2. Avatar for Grom 132. Grom Lv 1 2 pts. 8,511
  3. Avatar for becirrius 133. becirrius Lv 1 2 pts. 8,505
  4. Avatar for leehaggis 134. leehaggis Lv 1 2 pts. 8,498
  5. Avatar for sirius2016_Alimpiev 135. sirius2016_Alimpiev Lv 1 2 pts. 8,494
  6. Avatar for justjustin 136. justjustin Lv 1 1 pt. 8,486
  7. Avatar for Iron pet 137. Iron pet Lv 1 1 pt. 8,479
  8. Avatar for pandapharmd 138. pandapharmd Lv 1 1 pt. 8,478
  9. Avatar for xplocast1 139. xplocast1 Lv 1 1 pt. 8,472
  10. Avatar for borattt 140. borattt Lv 1 1 pt. 8,471

Comments