Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897
  1. Avatar for rezaefar 141. rezaefar Lv 1 1 pt. 8,468
  2. Avatar for frostschutz 142. frostschutz Lv 1 1 pt. 8,465
  3. Avatar for SouperGenious 143. SouperGenious Lv 1 1 pt. 8,463
  4. Avatar for herballemon 144. herballemon Lv 1 1 pt. 8,437
  5. Avatar for boondog 145. boondog Lv 1 1 pt. 8,437
  6. Avatar for Bulder 146. Bulder Lv 1 1 pt. 8,429
  7. Avatar for Anamfija 147. Anamfija Lv 1 1 pt. 8,410
  8. Avatar for racingsnailrider 148. racingsnailrider Lv 1 1 pt. 8,393
  9. Avatar for bzipitidoo 149. bzipitidoo Lv 1 1 pt. 8,393
  10. Avatar for Inkedhands 150. Inkedhands Lv 1 1 pt. 8,384

Comments