Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897
  1. Avatar for jencimons 151. jencimons Lv 1 1 pt. 8,384
  2. Avatar for lamoille 152. lamoille Lv 1 1 pt. 8,383
  3. Avatar for navn 153. navn Lv 1 1 pt. 8,374
  4. Avatar for The_Lunar_1 154. The_Lunar_1 Lv 1 1 pt. 8,372
  5. Avatar for impjong 155. impjong Lv 1 1 pt. 8,346
  6. Avatar for drumpeter18yrs9yrs 156. drumpeter18yrs9yrs Lv 1 1 pt. 8,344
  7. Avatar for gilleain 157. gilleain Lv 1 1 pt. 8,335
  8. Avatar for sa_simsalabim 158. sa_simsalabim Lv 1 1 pt. 8,325
  9. Avatar for Mike Cassidy 159. Mike Cassidy Lv 1 1 pt. 8,321
  10. Avatar for martinf 160. martinf Lv 1 1 pt. 8,313

Comments