Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897

  1. Avatar for roman madala 171. roman madala Lv 1 1 pt. 8,183
  2. Avatar for Ref_Jo 172. Ref_Jo Lv 1 1 pt. 8,155
  3. Avatar for andrey1978 173. andrey1978 Lv 1 1 pt. 8,153
  4. Avatar for RadekPL 174. RadekPL Lv 1 1 pt. 8,130
  5. Avatar for Altercomp 175. Altercomp Lv 1 1 pt. 8,127
  6. Avatar for DScott 176. DScott Lv 1 1 pt. 8,126
  7. Avatar for SlowSG 177. SlowSG Lv 1 1 pt. 8,125
  8. Avatar for placid.lion 178. placid.lion Lv 1 1 pt. 8,108
  9. Avatar for Cerzax 179. Cerzax Lv 1 1 pt. 8,089
  10. Avatar for Stixxy 180. Stixxy Lv 1 1 pt. 8,089

Comments