Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897
  1. Avatar for reefyrob 11. reefyrob Lv 1 80 pts. 9,274
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 78 pts. 9,254
  3. Avatar for markm457 13. markm457 Lv 1 76 pts. 9,246
  4. Avatar for Deleted player 14. Deleted player pts. 9,238
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 73 pts. 9,233
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 71 pts. 9,229
  7. Avatar for Vredeman 17. Vredeman Lv 1 69 pts. 9,223
  8. Avatar for crpainter 18. crpainter Lv 1 68 pts. 9,220
  9. Avatar for Mark- 19. Mark- Lv 1 66 pts. 9,215
  10. Avatar for Galaxie 20. Galaxie Lv 1 65 pts. 9,211

Comments