Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897
  1. Avatar for Bushman 41. Bushman Lv 1 38 pts. 9,101
  2. Avatar for Jim Fraser 42. Jim Fraser Lv 1 37 pts. 9,101
  3. Avatar for g_b 43. g_b Lv 1 36 pts. 9,098
  4. Avatar for isaksson 44. isaksson Lv 1 35 pts. 9,095
  5. Avatar for TomTaylor 45. TomTaylor Lv 1 34 pts. 9,077
  6. Avatar for Blipperman 46. Blipperman Lv 1 33 pts. 9,076
  7. Avatar for Deleted player 47. Deleted player pts. 9,060
  8. Avatar for Glen B 48. Glen B Lv 1 31 pts. 9,052
  9. Avatar for actiasluna 49. actiasluna Lv 1 30 pts. 9,039
  10. Avatar for joremen 50. joremen Lv 1 29 pts. 9,039

Comments