Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897

  1. Avatar for smilingone 51. smilingone Lv 1 29 pts. 9,036
  2. Avatar for Bletchley Park 52. Bletchley Park Lv 1 28 pts. 9,035
  3. Avatar for Vinara 53. Vinara Lv 1 27 pts. 9,017
  4. Avatar for johngran 54. johngran Lv 1 26 pts. 9,007
  5. Avatar for shettler 55. shettler Lv 1 25 pts. 9,004
  6. Avatar for tallguy-13088 56. tallguy-13088 Lv 1 25 pts. 8,992
  7. Avatar for toshiue 57. toshiue Lv 1 24 pts. 8,991
  8. Avatar for pfirth 58. pfirth Lv 1 23 pts. 8,984
  9. Avatar for phi16 59. phi16 Lv 1 23 pts. 8,983
  10. Avatar for jamiexq 60. jamiexq Lv 1 22 pts. 8,982

Comments