Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,880
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,841
  3. Avatar for xkcd 13. xkcd 2 pts. 8,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,712
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,618
  6. Avatar for Sirius 2016 01 16. Sirius 2016 01 1 pt. 8,494
  7. Avatar for Bad Monkey 17. Bad Monkey 1 pt. 8,191
  8. Avatar for freefolder 18. freefolder 1 pt. 8,127
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 8,076
  10. Avatar for Biochem-AD17 20. Biochem-AD17 1 pt. 7,897
  1. Avatar for severin333 81. severin333 Lv 1 11 pts. 8,864
  2. Avatar for Superphosphate 82. Superphosphate Lv 1 11 pts. 8,862
  3. Avatar for TastyMunchies 83. TastyMunchies Lv 1 11 pts. 8,848
  4. Avatar for diamonddays 84. diamonddays Lv 1 10 pts. 8,846
  5. Avatar for alwen 85. alwen Lv 1 10 pts. 8,845
  6. Avatar for MicElephant 86. MicElephant Lv 1 10 pts. 8,841
  7. Avatar for Mr_Jolty 87. Mr_Jolty Lv 1 9 pts. 8,841
  8. Avatar for mitarcher 88. mitarcher Lv 1 9 pts. 8,837
  9. Avatar for Mydogisa Toelicker 89. Mydogisa Toelicker Lv 1 9 pts. 8,836
  10. Avatar for DotMatrix 90. DotMatrix Lv 1 8 pts. 8,829

Comments