Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,614
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,394
  2. Avatar for Aubade01 2. Aubade01 Lv 1 98 pts. 9,372
  3. Avatar for dembones 3. dembones Lv 1 96 pts. 9,358
  4. Avatar for gitwut 4. gitwut Lv 1 94 pts. 9,340
  5. Avatar for Scopper 5. Scopper Lv 1 92 pts. 9,322
  6. Avatar for LociOiling 6. LociOiling Lv 1 90 pts. 9,314
  7. Avatar for Mike Lewis 7. Mike Lewis Lv 1 88 pts. 9,310
  8. Avatar for pmdpmd 8. pmdpmd Lv 1 86 pts. 9,286
  9. Avatar for johnmitch 9. johnmitch Lv 1 84 pts. 9,278
  10. Avatar for bertro 10. bertro Lv 1 82 pts. 9,276

Comments