Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,614
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,397
  2. Avatar for Deleted player 2. Deleted player 86 pts. 9,395
  3. Avatar for LociOiling 3. LociOiling Lv 1 73 pts. 9,395
  4. Avatar for reefyrob 4. reefyrob Lv 1 62 pts. 9,393
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 52 pts. 9,388
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 43 pts. 9,336
  7. Avatar for gitwut 7. gitwut Lv 1 36 pts. 9,336
  8. Avatar for georg137 8. georg137 Lv 1 30 pts. 9,334
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 24 pts. 9,321
  10. Avatar for Hollinas 10. Hollinas Lv 1 20 pts. 9,320

Comments