Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,397
  2. Avatar for Contenders 2. Contenders 78 pts. 9,358
  3. Avatar for Go Science 3. Go Science 60 pts. 9,322
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,311
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 9,286
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,246
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,229
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,132
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,101
  10. Avatar for Russian team 10. Russian team 6 pts. 8,921

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,397
  2. Avatar for Deleted player 2. Deleted player 86 pts. 9,395
  3. Avatar for LociOiling 3. LociOiling Lv 1 73 pts. 9,395
  4. Avatar for reefyrob 4. reefyrob Lv 1 62 pts. 9,393
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 52 pts. 9,388
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 43 pts. 9,336
  7. Avatar for gitwut 7. gitwut Lv 1 36 pts. 9,336
  8. Avatar for georg137 8. georg137 Lv 1 30 pts. 9,334
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 24 pts. 9,321
  10. Avatar for Hollinas 10. Hollinas Lv 1 20 pts. 9,320

Comments