Placeholder image of a protein
Icon representing a puzzle

1292: Revisiting Puzzle 73: Polycystein

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,397
  2. Avatar for Contenders 2. Contenders 78 pts. 9,358
  3. Avatar for Go Science 3. Go Science 60 pts. 9,322
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,311
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 9,286
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 24 pts. 9,246
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 9,229
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,132
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,101
  10. Avatar for Russian team 10. Russian team 6 pts. 8,921

  1. Avatar for mirjamvandelft 191. mirjamvandelft Lv 1 1 pt. 7,984
  2. Avatar for Tyssel 192. Tyssel Lv 1 1 pt. 7,973
  3. Avatar for Ciccillo 193. Ciccillo Lv 1 1 pt. 7,971
  4. Avatar for andrewxc 194. andrewxc Lv 1 1 pt. 7,968
  5. Avatar for Carlos Santamaria 195. Carlos Santamaria Lv 1 1 pt. 7,960
  6. Avatar for chaichontat.s 196. chaichontat.s Lv 1 1 pt. 7,950
  7. Avatar for borisvdm 197. borisvdm Lv 1 1 pt. 7,948
  8. Avatar for val.sch67 198. val.sch67 Lv 1 1 pt. 7,927
  9. Avatar for Karsten69 199. Karsten69 Lv 1 1 pt. 7,910
  10. Avatar for A01225950 200. A01225950 Lv 1 1 pt. 7,897

Comments