Placeholder image of a protein
Icon representing a puzzle

1293: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate

Summary


Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle was mistakenly posted without a Contact Bonus filter. The puzzle has been closed and reposted as Puzzle 1293b.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups


  1. Avatar for Beta Folders 100 pts. 9,359
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 47 pts. 9,229
  3. Avatar for Gargleblasters 3. Gargleblasters 19 pts. 9,142
  4. Avatar for Void Crushers 4. Void Crushers 7 pts. 8,640
  5. Avatar for Contenders 5. Contenders 2 pts. 8,562
  6. Avatar for Deleted group 6. Deleted group pts. 8,132
  7. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 1 pt. 1,822

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,359
  2. Avatar for LociOiling 2. LociOiling Lv 1 24 pts. 9,351
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 4 pts. 9,343
  4. Avatar for Galaxie 4. Galaxie Lv 1 1 pt. 9,229
  5. Avatar for hansvandenhof 5. hansvandenhof Lv 1 1 pt. 8,565

Comments