Placeholder image of a protein
Icon representing a puzzle

1293b: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,853
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,369
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,614
  4. Avatar for xkcd 14. xkcd 1 pt. 8,553
  5. Avatar for freefolder 15. freefolder 1 pt. 7,284
  6. Avatar for Biochem-AD17 16. Biochem-AD17 1 pt. 4,605
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,559
  8. Avatar for Rice Biochemistry 18. Rice Biochemistry 1 pt. 0
  1. Avatar for lzhchild 171. lzhchild Lv 1 1 pt. 4,926
  2. Avatar for Polowastaken 172. Polowastaken Lv 1 1 pt. 4,869
  3. Avatar for kywew3 173. kywew3 Lv 1 1 pt. 4,842
  4. Avatar for A01225950 174. A01225950 Lv 1 1 pt. 4,605
  5. Avatar for irenagrocka 175. irenagrocka Lv 1 1 pt. 4,409
  6. Avatar for evifnoskcaj 176. evifnoskcaj Lv 1 1 pt. 4,385
  7. Avatar for frostschutz 177. frostschutz Lv 1 1 pt. 4,286
  8. Avatar for bendbob 178. bendbob Lv 1 1 pt. 4,067
  9. Avatar for penteplayer 179. penteplayer Lv 1 1 pt. 3,987
  10. Avatar for iq2833 180. iq2833 Lv 1 1 pt. 3,673

Comments

bkoep Staff Lv 1

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).