Placeholder image of a protein
Icon representing a puzzle

1293b: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,853
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,369
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,614
  4. Avatar for xkcd 14. xkcd 1 pt. 8,553
  5. Avatar for freefolder 15. freefolder 1 pt. 7,284
  6. Avatar for Biochem-AD17 16. Biochem-AD17 1 pt. 4,605
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,559
  8. Avatar for Rice Biochemistry 18. Rice Biochemistry 1 pt. 0
  1. Avatar for Mark- 11. Mark- Lv 1 79 pts. 12,696
  2. Avatar for Mike Lewis 12. Mike Lewis Lv 1 77 pts. 12,668
  3. Avatar for Deleted player 13. Deleted player pts. 12,667
  4. Avatar for Skippysk8s 14. Skippysk8s Lv 1 74 pts. 12,643
  5. Avatar for LociOiling 15. LociOiling Lv 1 72 pts. 12,589
  6. Avatar for gitwut 16. gitwut Lv 1 70 pts. 12,391
  7. Avatar for jermainiac 17. jermainiac Lv 1 68 pts. 12,351
  8. Avatar for nicobul 18. nicobul Lv 1 67 pts. 12,319
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 65 pts. 12,311
  10. Avatar for markm457 20. markm457 Lv 1 63 pts. 12,211

Comments

bkoep Staff Lv 1

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).