Placeholder image of a protein
Icon representing a puzzle

1293b: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,853
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,369
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,614
  4. Avatar for xkcd 14. xkcd 1 pt. 8,553
  5. Avatar for freefolder 15. freefolder 1 pt. 7,284
  6. Avatar for Biochem-AD17 16. Biochem-AD17 1 pt. 4,605
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,559

  1. Avatar for dbuske 201. dbuske Lv 1 1 pt. 0
  2. Avatar for Grom 203. Grom Lv 1 1 pt. 0
  3. Avatar for Hollinas 204. Hollinas Lv 1 1 pt. 0
  4. Avatar for tammy_p 205. tammy_p Lv 1 1 pt. 0
  5. Avatar for crpainter 206. crpainter Lv 1 1 pt. 0
  6. Avatar for smkrause147 207. smkrause147 Lv 1 1 pt. 0
  7. Avatar for ivalnic 208. ivalnic Lv 1 1 pt. 0
  8. Avatar for aggeliki370 209. aggeliki370 Lv 1 1 pt. 0

Comments


bkoep Staff Lv 1

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).