Placeholder image of a protein
Icon representing a puzzle

1293b: Dysferlin C2B Domain: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
October 07, 2016
Expires
Max points
100
Description

Note: This puzzle replaces Puzzle 1293, which lacked a Contact Bonus filter. Players may load in solutions from Puzzle 1293.



This is a followup to Puzzle 1291, now with predicted contacts! This domain of the human dysferlin protein; see the blog for more info. Our collaborators at the Jain Foundation would like to model the structure of dysferlin to better understand its function, and have asked Foldit players to help! The structure of this protein domain is still unknown—fold up the extended chain to find a stable model and increase your score! Players may load in solutions from Puzzle 1291.



Sequence:


DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 14,429
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 13,552
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 13,171
  4. Avatar for Contenders 4. Contenders 38 pts. 13,141
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 13,009
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 12,319
  7. Avatar for Go Science 7. Go Science 12 pts. 12,032
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 10,898
  9. Avatar for Deleted group 9. Deleted group pts. 10,542
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 10,310
  1. Avatar for pizpot 191. pizpot Lv 1 1 pt. 2,655
  2. Avatar for Ronmore 192. Ronmore Lv 1 1 pt. 2,649
  3. Avatar for Tolen 193. Tolen Lv 1 1 pt. 2,484
  4. Avatar for GreyDex 194. GreyDex Lv 1 1 pt. 2,313
  5. Avatar for krisha_lim 195. krisha_lim Lv 1 1 pt. 0
  6. Avatar for Parnikkapore 196. Parnikkapore Lv 1 1 pt. 0
  7. Avatar for 01010011111 197. 01010011111 Lv 1 1 pt. 0
  8. Avatar for momadoc 198. momadoc Lv 1 1 pt. 0
  9. Avatar for justjustin 199. justjustin Lv 1 1 pt. 0
  10. Avatar for jesusyanez15 200. jesusyanez15 Lv 1 1 pt. 0

Comments

bkoep Staff Lv 1

Yes, there is a lot of data to support these contact predictions. Most of the contacts are high confidence (bright green).