Placeholder image of a protein
Icon representing a puzzle

1296: Electron Density Reconstruction 1: Original Density

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
October 17, 2016
Expires
Max points
100
Description

This is a followup to Puzzle 1249 and Puzzle 1274, this time with a density map drawn directly from the published structure. Players may load in solutions from Puzzle 1249 and Puzzle 1274.



The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.



Sequence:


SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 8,819
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 8,797
  3. Avatar for freefolder 13. freefolder 1 pt. 8,561
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,447
  5. Avatar for Foldit UK 15. Foldit UK 1 pt. 7,821
  6. Avatar for Russian team 16. Russian team 1 pt. 7,806
  7. Avatar for Biochem-AD17 17. Biochem-AD17 1 pt. 5,362
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 1,457
  9. Avatar for HMT heritage 19. HMT heritage 1 pt. 0
  10. Avatar for Window Group 20. Window Group 1 pt. 0

  1. Avatar for SaraL 131. SaraL Lv 1 1 pt. 6,505
  2. Avatar for Cerzax 132. Cerzax Lv 1 1 pt. 6,314
  3. Avatar for Anamfija 133. Anamfija Lv 1 1 pt. 6,167
  4. Avatar for tarimo 134. tarimo Lv 1 1 pt. 6,126
  5. Avatar for sa_simsalabim 135. sa_simsalabim Lv 1 1 pt. 6,075
  6. Avatar for dieckie 136. dieckie Lv 1 1 pt. 5,842
  7. Avatar for mcummings 137. mcummings Lv 1 1 pt. 5,826
  8. Avatar for Tyssel 138. Tyssel Lv 1 1 pt. 5,823
  9. Avatar for Nbbroo 139. Nbbroo Lv 1 1 pt. 5,676
  10. Avatar for nagistick 140. nagistick Lv 1 1 pt. 5,633

Comments


Bruno Kestemont Lv 1

When loading an old shared solution, we need the oldest solution points + 2 to evolve instead of the current score + 2. This makes about 100 points to evolve.

gitwut Lv 1

How is this different from 1249? I've reread 1249 and 1274. Isn't this the same map data used in 1249? Maybe I've forgotten, have the ED tools been re-worked since then?

Bruno Kestemont Lv 1

Top score 1249 was about 13600 (but about 1000 pts less when we load it)
Top score 1274 was about 12000

If I load the best old score, I would be encouraged to work on 1249 solutions (with same cloud). What is then the expected use of 1274?

Are the score functions the same? (it seems not)

The good news is that 1274 was very slow and this problem seems solved now.

Bruno Kestemont Lv 1

Great idea to let us work on a 1274's player's design first developed in 1249 by only a few talentuous players. This helped everybody to get a "soloist" design into the cloud, which we can now further develop without a long difficult hand fold and with a published (aparently trimmed ?) cloud.

bkoep Staff Lv 1

In Puzzle 1249, we took some steps to reduce model bias in the density map (see this comment).

This density map should appear much cleaner and less noisy than Puzzle 1249, though it is more prone to model bias (parts of the map may be artificially reinforced to agree with the published structure).

Skippysk8s Lv 1

I finally loaded the new client…. but this puzzle still doesn't work for me. I load an evo share and need over 1000 points to get to evo? This puzzle is broken. please zero me out. I'd really like to learn to work these. This is not the way
Suggestions in abundance on the forum thread from many players. Give us training tools please

actiasluna Lv 1

This one is a) too big for my new-to-ED eyes to see the structures, and b) can't get a good evo score due to how the evo score is being calculated, which currently is my only hope for such a large puzzle as not sufficient hours in the day between work and sleep to work this one as it needs to be worked from scratch.

Almost didn't post this as I don't want to be seen as "whining" … I know all are in the same "scoring" boat on this, with only the best old puzzle scorers and experienced ED players having a slight edge. That written, the more we get to practice on smaller easier to see puzzles, the better our less-experienced folders will get, and quicker… which ultimately is good for the science. Thus this comment. - Thanks