Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 8,810
  2. Avatar for freefolder 12. freefolder 4 pts. 8,704
  3. Avatar for Deleted group 13. Deleted group pts. 8,466
  4. Avatar for SETI.Germany 14. SETI.Germany 2 pts. 8,466
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,451
  6. Avatar for Deleted group 16. Deleted group pts. 8,407
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,395
  8. Avatar for Deleted group 18. Deleted group pts. 8,382
  9. Avatar for Biochem-AD17 19. Biochem-AD17 1 pt. 8,301
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,294

  1. Avatar for markm457
    1. markm457 Lv 1
    100 pts. 9,002
  2. Avatar for Aubade01 2. Aubade01 Lv 1 98 pts. 9,002
  3. Avatar for johnmitch 3. johnmitch Lv 1 96 pts. 8,998
  4. Avatar for Jim Fraser 4. Jim Fraser Lv 1 94 pts. 8,994
  5. Avatar for georg137 5. georg137 Lv 1 92 pts. 8,994
  6. Avatar for randomlil 6. randomlil Lv 1 89 pts. 8,990
  7. Avatar for nicobul 7. nicobul Lv 1 87 pts. 8,990
  8. Avatar for LociOiling 8. LociOiling Lv 1 85 pts. 8,987
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 83 pts. 8,985
  10. Avatar for diamond_dust 10. diamond_dust Lv 1 81 pts. 8,985

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)