Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,009
  2. Avatar for Deleted player 2. Deleted player pts. 9,008
  3. Avatar for dembones 3. dembones Lv 1 76 pts. 9,000
  4. Avatar for georg137 4. georg137 Lv 1 65 pts. 8,999
  5. Avatar for gitwut 5. gitwut Lv 1 56 pts. 8,999
  6. Avatar for jermainiac 6. jermainiac Lv 1 48 pts. 8,996
  7. Avatar for lamoille 7. lamoille Lv 1 41 pts. 8,994
  8. Avatar for diamond_dust 8. diamond_dust Lv 1 34 pts. 8,991
  9. Avatar for smilingone 9. smilingone Lv 1 29 pts. 8,988
  10. Avatar for alwen 10. alwen Lv 1 24 pts. 8,987

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)