Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for Restartbob 91. Restartbob Lv 1 7 pts. 8,774
  2. Avatar for Glen B 92. Glen B Lv 1 7 pts. 8,770
  3. Avatar for Superphosphate 93. Superphosphate Lv 1 7 pts. 8,767
  4. Avatar for rezaefar 94. rezaefar Lv 1 6 pts. 8,760
  5. Avatar for SouperGenious 95. SouperGenious Lv 1 6 pts. 8,760
  6. Avatar for Deleted player 96. Deleted player pts. 8,760
  7. Avatar for eromana 97. eromana Lv 1 6 pts. 8,752
  8. Avatar for jebbiek 98. jebbiek Lv 1 5 pts. 8,748
  9. Avatar for deLaCeiba 99. deLaCeiba Lv 1 5 pts. 8,748
  10. Avatar for steveB 100. steveB Lv 1 5 pts. 8,748

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)